The Human Fibroblast Growth Factor 19

by

Larry P. Taylor, Ph. D.

 

Feedback appreciated; please send comments to:

Email: lpt

Molecular & Behavioral Neuroscience Institute

The University of Michigan

Ann Arbor, MI

My University Home   Harris Links     Chemistry / Modeling Links

FGF Site: FGF Intro     Nomenclature     Notes     References      FGF Sequences     FGFR Sequences     Site Map

The Human Fibroblast Growth Factor 19

The most studied FGF species, FGF 1 and FGF 2, bind to all of the known FGF receptors. FGF 19, in sharp contrast, binds only to FGF 4. 

 

The unit cell for FGF 19 is shown in Kinemage 1. Kinemage 2 adds ribbon rendering and Kinemage 3 shows the secondary structure cartoon for the unit cell. The characteristics of the unit cell for this structure are summarized at pdbsum.

FGF 19 has 2 disulphide bonds. This is unique among previously crystallized (FGF 1, 2, 4, 7, 9, & 10) FGF molecules. Since it has the lowest sequence identity among the 23 known FGF proteins, it is considered the most divergent FGF protein. It also shows an extended C-terminal end and a flexible (13 residues which are not resolved in the X-ray experiment) portion corresponding to beta strand 11 in FGF 1 and 2. The disulphide links stabilize the loop regions that are different in FGF 19.

Cys-120 (involved in a disulphide link to Cys-102) is the only amino acid absolutely conserved across all known FGF sequences. The significance of this conservation is unknown,

FGF-19 shows an extended loop in the region corresponding to the FGF 2 turn between beta sheets 1 and 2. The disulphide bridge connecting Cys-58 to Cys-70 would stabilize this loop. In addition, the captured sulfate ion (Kinemage 4 )  forms hydrogen bonds with the amide backbone of residues His-53, Leu-35, and Ser-56. Since this is in the region where the FGF ligand interacts with heparin and Domain 3 of the FGF receptors, this extended loop undoubtedly is a contributor to differences in physiological response of FGF 19 compared to FGF 1 and 2.
.
The most striking feature of the FGF crystal structure is the inability to resolve the loop corresponding to beta sheet 11 in other FGF molecules. This suggests a conformational mobility in this region of the molecule not seen in other FGF species. This altered loop region may explain the observed decrease (compared to FGF 1 and 2) in FGF 19 binding to heparin This difference (comparison to FGF 2) is highlighted in Kinemage 5

In summary, the divergence in biological activity of FGF 19 can be explained by a structure that has significant structural differences compared to other FGF species.

Ribbon Cartoon of FGF 2 and  FGF 19

Arrow Color

 Description Ribbon Color Description
Red  N-terminal End Magenta alpha
Yellow  C-terminal End Yellow beta
Green  Extended Loop Cyan coil
Orange Unresolved Loop

 

The Kinemages

 

A single click on the KiNG logo will launch the appropriate kinemage. The number below the KiNG logo is the download size (in bytes).

Use the left mouse button to rotate the molecule.

If the KiNG logo is absent or the application does not launch, see Gray Box Error.

Kinemage 1:  Calpha Backbone Trace of FGF 19

 



Image requires a Java enabled browser

24 K

Click on KiNG to see Calpha Trace of FGF 19

 

Kinemage 2: Ribbon View of FGF 19

 



Image requires a Java enabled browser

215 K

Click on KiNG to see  Ribbon Rendering of FGF 19

 

Kinemage 3: Secondary Structure Cartoon of FGF 19

 



Image requires a Java enabled browser

180 K

Click on KiNG to see  Cartoon of FGF 19

 

Kinemage 4: FGF 19 Sulfate Ion Binding Site

The captured sulfate ion forms hydrogen bonds with the amide backbone of residues His-53, Leu-35, and Ser-56. Since this is in the region where the FGF ligand interacts with heparin and Domain 3 of the FGF receptors, this extended loop undoubtedly is a contributor to differences in physiological response of FGF 19 compared to FGF 1 and 2.
.
View 1  FGF 19
View 2  closer view of the sulfate binding site

 



Image requires a Java enabled browser
184 K
Click on KiNG to see  FGF 19 Sulfate Ion Binding Site

 

Kinemage 5: FGF 19 Superimposed Upon FGF 2


View 1 shows FGF 19 superimposed on the backbone of FGF 2
View 2 centers on the low affinity (discrimination) loop.
View 3 is looking directly into the heparin binding region (the "basic Canyon") 
View 4 is centered on the N & C terminal junction

 



Image requires a Java enabled browser

326 K

Click on KiNG to see FGF 19 Superimposed on FGF 2

  

Sequence: (X-Ray resolved residues 41- 176 of the rat FGF 19 sequence.)

Unresolved N-Terminal: GSMSGD

X-ray Resolved: PIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKA 
VALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLS 

Unresolved Loop 11: SAKQRQLYKNRGF

X-Ray Resolved: LPLSHFLPMLPMVPEEP

Unresolved C-Terminal: EDLRGHLESDMFSSPLETDS 


Source:

The rat sequence was expressed in escherichia coli; Structural coordinates were taken from the Brookhaven Database file1PWA.

Top

FGF Site: FGF Intro     Nomenclature     Notes     References     FGF Sequences     FGFR Sequences     Site Map

My University Home   Harris Links     Chemistry / Modeling Links


Copyright 2005-2007 by Larry P. Taylor
Molecular & Behavioral Neuroscience Institute
University of Michigan

All Rights Reserved

Supported by the Pritzker Neuropsychiatric Disorders Research Consortium, and by NIH Grant 5 P01 MH42251, Conte Center Grant #L99MH60398, RO1 DA13386 and the Office of Naval Research (ONR) N00014-02-1-0879 to Huda Akil & Stanley J. Watson. at the Molecular & Behavioral Neuroscience Institute.