Human Fibroblast Growth Factor 4

by

Larry P. Taylor, Ph. D.

 

Feedback appreciated; please send comments to:

Email: lpt

Molecular & Behavioral Neuroscience Institute

The University of Michigan

Ann Arbor, MI

My University Home   Harris Links     Chemistry / Modeling Links

FGF Site: FGF Intro     Nomenclature     Notes     References     FGF Sequences     FGFR Sequences    Site Map

Human Fibroblast Growth Factor 4

 

Growth factors represent a family of at least 18 proteins with a beta trefoil (three-fold repeat of a four-stranded sheet assembly without extended alpha helix strands) motif associated with cell proliferation and differentiation. They are a prime component of angiogenesis associated with organogenesis, tumor growth, and wound healing. 

FGF molecules function by interacting with FGF receptors. These receptors typically contain Ig-like binding domains (with domains D2 and D3 being most involved in FGF-FGF receptor interactions), a short transmembrane spanning domain and a cytoplasmic component that possesses tyrosine kinase activity. An essential component of biological activity is the heparin-mediated dimerization of the FGF receptor.

The FGF 4 molecule is shown with ribbon rendering in Kinemage 1. The cartoon rendering is displayed in Kinemage 2.

Kinemage 3 highlights the FGF residues involved in ligand-receptor interactions (based on a structural overlay of FGF 4 upon an FGF 2 molecule binding to the FGFR 1 receptor. Differences between FGF 4 and FGF 1 & FGF 2 occur primarily at beta sheets 1 and 2, 3 and 4, and 9 and 10. These loops interact with the ligand binding domain of FGF receptors and are most likely the determining factor in FGF 4's binding profile.

Residues implicated in major hydrophobic contact roles with the D2 Domain of the receptor include conservative residues Tyr-87, Tyr-166, and Leu-203. FGF 4 residues His-95 and Arg-205 lessen hydrophobic interactions between ligand and receptor, especially compared to FGF 2 comparable residues Phe-40 and Met-151.

Conserved residue Asn-167 forms a critical H-bond to the invariant D2-D3 Linker Arg residue.

Ligand-receptor interactions at D3 center around contact between invariant residue Glu-159 and receptor invariant residue Other important residues include Glu-117, Ser-119, Val-121, Phe-129, Phe-136, and Phe-151.

Kinemage 4 highlights residues that interact with heparin. They are Asn-89, Lys-183, and Lys-188.

FGF 4 has approximately 30% sequence identify of the FGF 1 & 2 sequences. It is unique in that the molecule is the only FGF molecule with a signal sequence preceding the trefoil structure of the growth factor, FGF 4 shows a binding preference for the IIIc splice variant of FGFR 1-3, with little binding to either the IIIb variant of FGFR 1-3 or FGFR 4. A structural overlay of FGF 4 compared to FGF 1 and FGF 2 is shown in Kinemage 5.

 

The Kinemages:

 

A single click on the KiNG logo will launch the appropriate kinemage. The number under the KiNG logo is the download size (in bytes).

Use the left mouse button to rotate the molecule.

If the KiNG logo is absent or the application does not launch, see Gray Box Error.

 

Kinemage 1: FGF 4 Ribbon Rendering

 



Image requires a Java enabled browser

211 K

Click on KiNG to see  

FGF 4 Ribbon

 


Kinemage 2: FGF 4 Cartoon Rendering

 



Image requires a Java enabled browser

170 K

Click on KiNG to see  

FGF 4 Cartoon

 

  Kinemage 3: Receptor Binding Residues

 



Image requires a Java enabled browser

180 K

Click on KiNG to see  

Receptor Binding Residues

 

Kinemage 4: Heparin Binding Residues

 



Image requires a Java enabled browser

180 K

Click on KiNG to see  

Heparin Binding Residues

 

 Kinemage 5 : Backbone Overlays

View 1 The Overlays
View 2 Sheet 1 & 2
View 3 Sheet 3 & 4
View 4 Sheet 9 & 10

 



Image requires a Java enabled browser

 507 K

Click on KiNG to see  

Backbone Overlays

 

Sequence: (corresponding to human FGF 4 (79-206 )

 

GIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFK
EILLPNNYNAYESYKYPGMFIALGKNGKTKKGNRVSPTMKVTHFLPRL


Source:

 

The appropriate DNA sequence was subcloned into the pET-15b bacterial expression vector and transformed in E coli. The structural coordinates were taken from Brookhaven Database File 1IJT.

Top

 

FGF Site: FGF Intro     Nomenclature     Notes     References     FGF Sequences     FGFR Sequences     Site Map

 

My University Home   Harris Links     Chemistry / Modeling Links

 

Copyright 2005-2007 by Larry P. Taylor
Molecular & Behavioral Neuroscience Institute
University of Michigan

 

All Rights Reserved

 

Supported by the Pritzker Neuropsychiatric Disorders Research Consortium, and by NIH Grant 5 P01 MH42251, Conte Center Grant #L99MH60398, RO1 DA13386 and the Office of Naval Research (ONR) N00014-02-1-0879 to Huda Akil & Stanley J. Watson. at the Molecular & Behavioral Neuroscience Institute.