 |
 |
|
Calpha trace for 24 Confomers |
FGF 1 Cartoon Rendering |
|
A Mutant Human Fibroblast Growth Factor 1 by Larry P. Taylor, Ph. D.
Feedback appreciated; please send comments to: Email: lpt Molecular & Behavioral Neuroscience Institute The University of Michigan Ann Arbor, MI |
My University Home Harris Links Chemistry / Modeling Links
FGF Site: FGF Intro Nomenclature Notes References FGF Sequences FGFR Sequences Site Map
A Mutant Human Fibroblast Growth Factor 1
Growth factors represent a family of at least 18 proteins with a beta trefoil (three-fold repeat of a four-stranded sheet assembly without extended alpha helix strands) motif associated with cell proliferation and differentiation. They are a prime component of angiogenesis associated with organogenesis, tumor growth, and wound healing. The characteristics of the unit cell for this structure are summarized at pdbsum.
The
human FGF 1 structure and its receptor interactions
are described on a separate
page. This page highlights nmr studies on a mutant form of FGF 1. The experiment produced 24 different
conformations. (The Calpha trace for all 24 species is shown below left). The multiple
structures are also shown in Kinemage 1. Clicking on the FGF 1 cartoon (below right) will launch a shockwave animation
(requires shockwave
browser plug-in) which uses these 24 structures to simulate the molecular
dynamics of the FGF 1 molecule.
|
|
|
Calpha trace for 24 Confomers |
FGF 1 Cartoon Rendering |
The overlay of multiple conformations highlights the most flexible areas of the molecule. The mutant FGF 1 species is also displayed as ribbon (Kinemage 2 ) and a secondary structure cartoon ( Kinemage 3).
The Kinemages:
The real-time visualization using KiNG of the structures on this site requires a java-enabled (JRE from Java) browser.
Possible Icons to the left of molecular model image on the download page
| Java Not Activated | Java Not Activated | Java Functional |
 |
Blank Area
or message: Image requires a Java enabled browser
|
 |
| KiNG Inactive | KiNG Inactive | KiNG Full Functional |
A single click on the KiNG logo will launch the appropriate kinemage.
Kinemage 1: FGF 1 Conformations
Use the Animation Button to toggle through the 24 different conformations of this mutant FGF 1. Doing this rapidly provides a sense of the dynamics of the molecule.
|
890 K |
 |
| Click on KiNG to see | FGF 1 Conformations |
Kinemage 2: FGF 1 Ribbon Rendering
|
200 K |
 |
| Click on KiNG to see | FGF 1 |
Kinemage 3: FGF 1 Cartoon Rendering
|
150 K |
 |
| Click on KiNG to see | FGF 1 Cartoon |
Sequence: (Human FGF 1, residues 28-154 of human sequence with AAA Added N-terminus)
AAALLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERL
EENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
This engineered protein replaced human residues 24,25,26 with Ala and Leu for
Met-27.
Source:
The engineered expression vector (pMG624A) was expressed in Escherichia coli AB 1899. The structural coordinates were taken from Brookhaven Database File 1DZC,
FGF Site: FGF Intro Nomenclature Notes References FGF Sequences FGFR Sequences Site Map
My University Home Harris Links Chemistry / Modeling Links
Copyright 2005-2020 by Larry P. Taylor
Molecular & Behavioral Neuroscience Institute
University of Michigan
All Rights Reserved
Supported by the Pritzker Neuropsychiatric Disorders Research Consortium, and by NIH Grant 5 P01 MH42251, Conte Center Grant #L99MH60398, RO1 DA13386 and the Office of Naval Research (ONR) N00014-02-1-0879 to Huda Akil & Stanley J. Watson. at the Molecular & Behavioral Neuroscience Institute.