The Human Basic Fibroblast Growth factor (FGF 2)

by

Larry P. Taylor, Ph. D.

 

Feedback appreciated; please send comments to:

Email: lpt

Molecular & Behavioral Neuroscience Institute

The University of Michigan

Ann Arbor, MI

My University Home   Harris Links     Chemistry / Modeling Links

FGF Site: FGF Intro     Nomenclature     Notes     References    FGF Sequences     FGFR Sequences    Site Map

The Human Basic Fibroblast Growth factor (FGF 2)

Basic FGF (FGF 2)  is one of the best characterized FGF molecular structures. The Calpha trace of unit cell is shown in Kinemage 1. Addition of side chains and a ribbon cartoon of the structure is shown in Kinemage 2. The FGF ligand molecules all share a characteristic architecture: the beta trefoil (three-fold repeat of a four-stranded sheet assembly without extended alpha helix strands possessing a pseudo three-fold axis of symmetry) motif. This motif is highlighted in Kinemage 3. There is a disulphide bond between the peptide chain residue Cys-77 and a beta-mercaptoethanol (bme) molecule. The beta-mercaptoethanol was added to the crystallization buffer to prevent disulphide mediated polymerization during crystallization. The characteristics of the unit cell for this structure are summarized at pdbsum.

Many of the 67 ordered waters have locations conserved across similar FGF molecules. This suggests a relatively rigid protein structure with possible water-mediated hydrogen bonding within the FGF playing a role in either structure of the protein itself or in the protein's interaction with its receptor or other molecules.

The crystal shows an ordered phosphate ion held by residues Asn-35, Arg-28,  and Lys-133  ( Kinemage 4) that resides in the vicinity of the "basic canyon" (Kinemage 6) that is associated with heparin binding to the FGF molecule.

There are two distinctly different binding regions ( Kinemage 5 ) on the surface of the FGF molecule that are involved in FGF receptor binding. The primary high affinity binding site is a non-contiguous surface arrangement of FGF 2 residues Tyr-32, Asn-35, Arg-52, Tyr-111, Leu-148, Pro-149, and Met-158. The lower affinity region is a contiguous loop of residues with residues Arg-117, Lys-118, Tyr-119, Thr-120, Ser-121 and Trp-122. The low affinity loop varies in size and sequence across the various FGF molecules. This suggests that this region of the molecule is involved in selectively or differentiation.

Basic FGF (FGF 2) shows a local surface concentration of predominately positively charged residues that has been called the "Basic Canyon."  These residues (Asn-35, Lys-127, Arg-128, Lys-133, Lys-137, Gln-142, and Lys-143) are complimentary to the poly-anion structure of  heparin and stabilize the formation of an FGF-heparin complex. This canyon is shown in Kinemage 6.

The human gene for FGF 2 encodes a 155 residue protein. However, because of N-terminal enzymatic degradation, protein isolation schemes from biological sources typically shorten the full sequence to 140-146 residues. Thus, biological activity studies have been primarily carried out on a protein of 146 residues. This specific protein (1BFF) was isolated from cDNA encoding the full gene. This 154 residua protein shows no difference in biological activity compared to previously isolated shorter forms of FGF 2. The X-ray diffraction experiment on the 154 residue basic FGF only resolves positions 26-154 because of N-terminal conformational mobility which does not provide an interpretable x-ray diffraction pattern. 

The Kinemages

 

A single click on the KiNG logo will launch the appropriate kinemage. The number under the KiNG logo is the download size (in bytes).

Use the left mouse button to rotate the molecule.

If the KiNG logo is absent or the application does not launch, see Gray Box Error.

Kinemage 1:  The "Classic" Kinemage

This is an alpha carbon trace of the peptide backbone for basic FGF 

 



Image requires a Java enabled browser

12 K

Click On KiNG to see  Calpha Carbon Trace of Basic FGF

 

Kinemage 2:  Ribbon Rendering of the Basic FGF Molecule

 



Image requires a Java enabled browser

260 K

Click On KiNG to see  Ribbon Rendering of Basic FGF

 

Kinemage 3:  The Trefoil Architecture

The ribbon rendering highlights the three distinct groups of four beta sheets each that comprise the trefoil motif.  The three folds are depicted as  Fold 1 (Red),  Fold 2 (Yellow) and  Fold 3 (Blue) with each separate beta sheet individually visible via toggle buttons.  The base of the trefoil (sheets 1, 4, 5, 8,  9, & 12) form a beta barrel motif. 

The Beta Sheets Of the Trefoil Motif

Fold 1               

                    Fold 2     

                                Fold 3               
Sheet Residues Sheet Residues Sheet Residues
1 28-34 4 60-67 8 101-107
2 37-4 5 59-76 9 110-117 
3 46-51 6 79-85 10 122-127  
12 146-152 7 89-93 11 130-133  

 

View 1   ribbon only rendering of FGF 2 highlighting the trefoil architecture.
View 2   shows the molecule rotated to emphasize the three distinctive folds of the trefoil architecture. This arrangement is maintained by the fold (in red) in which the two beta sheets 1 and 12 bring together the C and N-terminal ends of the protein. The stability of the this junction may play a key role in regulation of this molecule.

 



Image requires a Java enabled browser

310 K

Click On KiNG to see The beta Sheets of Basic FGF


  Kinemage 4:  The Apparent Phosphate Ion Binding Site

View 1  highlights phosphate binding residues Asn-35, Arg-28,  and Lys-133,
View 2  a closer view

 



Image requires a Java enabled browser

254 K

Click On KiNG to see  Phosphate Binding Site

 

Kinemage 5:  The Receptor Binding Regions

There  are two distinctly different binding regions on the surface of the FGF molecule that are involved in FGF receptor binding. The primary high affinity binding site is a non-contiguous surface arrangement of residues comprised of Tyr-32,  Asn-35,  Arg-52, Tyr-111, Leu-148, Pro-149, and Met-158. The lower affinity region is a contiguous loop of residues with residues Arg-117,  Lys-118, Tyr-119, Thr-120, Ser-121 and Trp-122.. The low affinity loop varies in size and sequence across the various FGF molecules. This suggests that this region of the molecule is involved in selectively or differentiation.

View 1  FGF 2 molecule showing high (Yellow Ribbon Strips ) and low (Red Ribbon Strip) affinity binding regions.
View 2  demonstrates that the high and low affinity binding regions are on opposite surfaces of the molecule
View 3  highlights the non-contiguous region of the high affinity site.
View 4  highlights the low affinity loop region.



Image requires a Java enabled browser

232 K

Click On KiNG to see  Receptors Binding Sites of Basic FGF

 

Kinemage 6:  The "Basic Canyon" of Basic FGF (FGF 2)

Basic FGF with the residues implicated in heparin binding  are Asn-35, Lys-127, Arg-128, Lys-133, Lys-137, Gln-142, and Lys-143.


View 1  highlights the  "Basic Canyon" 
View 2  close-up of the "Basic Canyon."

 



Image requires a Java enabled browser

229 K

Click On KiNG to see  Heparin Binding Sites of Basic FGF


Sequence: (The X-Ray resolved residues are 26-154 of the human FGF 2 sequence.)


Unresolved N-Terminal: AAGSITTLPALPEDGGSGAFPPGHF

X-Ray Resolved: KDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH
IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLE
SNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS 

Source:

The human sequence was expressed in escherichia coli; Structural Coordinates were taken from the Brookhaven Data Base File1BFF.

Top

FGF Site: FGF Intro     Nomenclature     Notes     References     FGF Sequences     FGFR Sequences    Site Map

My University Home   Harris Links     Chemistry / Modeling Links


Copyright 2005-2007 by Larry P. Taylor
Molecular & Behavioral Neuroscience Institute
University of Michigan

All Rights Reserved

Supported by the Pritzker Neuropsychiatric Disorders Research Consortium, and by NIH Grant 5 P01 MH42251, Conte Center Grant #L99MH60398, RO1 DA13386 and the Office of Naval Research (ONR) N00014-02-1-0879 to Huda Akil & Stanley J. Watson. at the Molecular & Behavioral Neuroscience Institute.